PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016809-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 392aa    MW: 43623.4 Da    PI: 10.336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016809-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.86e-14184228347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
    NNU_016809-RA 184 PWTEEEHRLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 228
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.73100115IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.48177233IPR017930Myb domain
SuperFamilySSF466893.66E-17179234IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-17180231IPR006447Myb domain, plants
SMARTSM007172.2E-10181231IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-11183228IPR009057Homeodomain-like
PfamPF002494.3E-11184228IPR001005SANT/Myb domain
CDDcd001673.43E-9184229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
LIGRFQVNHA NQQSNAKAIH YINEAPLAIL IFRKTHLFLL PFFHLVLWAS DFVVRSEILL  60
PRFLRKQKEK NIAERKNKQQ EISKPNPYRP PTRMSQSRSC SQCGNNGHNS RTCSEAVAAS  120
ESTGGFMLFG VRVIEGSIRK TVSMNNLSQY EQPQEPNSDV NAGYASDDVC HASAGNRERK  180
RGVPWTEEEH RLFLVGLQKV GKGDWRGISR NFVKTRTPTQ VASHAQKYFL RRNNLNRRRR  240
RSSLFDITTD TFMGLPIEEE TVHQETATQP PAPVNCNIAY PVPAFPVTLS PVVLPGSGEN  300
PAESLTLVQS DLTRAPTKLV RPIPVLPIPP ASRMANLNLN QQSSMDPSPL SLKLFTPSSD  360
QQPSSRHSAF QSMSNFSAGE LDSNGGSIIS VA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272144.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B06e-66MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA5C6311e-121A5C631_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01050.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.24e-71MYB_related family protein